PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT31467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 830aa    MW: 91520.1 Da    PI: 7.7079
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT31467genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.4e-28514564252
    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               ek++sl +l++yF++++kdAA++Lgvc+T+LKriCRq+GI+RWP+Rkik++
  EMT31467 514 EKTVSLPVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGINRWPSRKIKKV 564
               799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.45503584IPR003035RWP-RK domain
PfamPF020429.5E-25517564IPR003035RWP-RK domain
SuperFamilySSF542774.91E-20722815No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-23729813No hitNo description
PROSITE profilePS5174519.144732815IPR000270PB1 domain
SMARTSM006661.4E-20732815IPR000270PB1 domain
CDDcd064075.98E-40733813No hitNo description
PfamPF005641.1E-15733813IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MGRALSSEGD LDLLEQLLSG DNAWLEVAPN TSRSPNFFAS PSTFLSDATT TTTTPASTNN  60
ALWIQSGSST VRQRLDQALA YIKEMQRDVG MLVQLWVPIK SGEGQLVLST SGQPFTLDET  120
SERLRQFREV STRYQFSADV ASESSPIGLP GRVFIGKLPE WSPDVRYFTS YEYPRVNHAQ  180
YLDVHGTMGL PVFEKGSYSC LGVMELIMTR QKLNFTSEIN NICSALQAVN LRSTEVSSIP  240
RATKFNSASY KDALPEILEV LRAACVTHKL PLAQTWVTCA QQEKRGSRHS DENYRHCIST  300
IDAACYVNDP QMQNFHESCS DHHLLRDQGV AGKAFSTNQP CFLPDIGSST KMEYPLSHHA  360
KIFNLKGAVA IRLRCTRTGT ADFVLEFFLP TNCEALEEQK AVLDSLSGTM RSTCRTLRVV  420
TDKEMGDEKM LEVNELNSFG PQGKNKVEEL SFGDQATEHR EEASWTSLAG TSKESDLAEL  480
SIHGMLSPVG QGLSPAGAQT SAQGSKGKRR TKTEKTVSLP VLRQYFAGSL KDAARSLGVC  540
PTTLKRICRQ HGINRWPSRK IKKVDHSLRK LQQIIDSVHG GETAFQLNTL YKDLTNTSVS  600
SDNNLSGSVT VPPHKQSNLT DFEGHRHHRL NSNVPSTSHS HSSCSQSSDS SPSSCSGGST  660
KHPPQAGVDL LMSGNPVNHS PVQTLQTENA SIRGHFPVQE APDLLHNLNQ KALGGQHSSR  720
SPSPPKQNAD AGMRIKATFG SEKVRFRLKP ECSFQELKQE MARRLSIVDT SFLIVKYLDD  780
DLEWVLMTCD ADLQECLHVY KLANLQTVKI SVHLAPIREA RVTIGHTGLS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3586000.0AK358600.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1079K24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578585.10.0PREDICTED: protein NLP1 isoform X3
RefseqXP_014758419.10.0PREDICTED: protein NLP1 isoform X3
RefseqXP_014758420.10.0PREDICTED: protein NLP1 isoform X3
TrEMBLM8CV140.0M8CV14_AEGTA; Uncharacterized protein
STRINGMLOC_9982.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein